---

Last Updated: March 19, 2026
Author: Palmetto Peptides Research Team
Reading Time: Approximately 18 to 22 minutes

---

Research Disclaimer: This guide is written strictly for educational and scientific research purposes. TB-500 and all peptides sold by Palmetto Peptides are intended for in vitro laboratory research use only. These products are not approved by the U.S. Food and Drug Administration (FDA) for any human or veterinary therapeutic use and should not be administered to humans or animals. Nothing in this document constitutes medical advice, a treatment recommendation, or a clinical claim. Always consult applicable laws and regulations before purchasing or using any research compound.

---

Palmetto Peptides Complete Guide to the Research Peptide TB-500

TB-500 is one of the most widely referenced synthetic research peptides in the scientific literature on tissue repair, actin biology, and cellular regeneration. If you have been exploring the peptide research space for any length of time, you have almost certainly come across this compound. The name gets thrown around a lot, sometimes accurately and sometimes not, which is exactly why a thorough, grounded guide is worth having in your corner.

This page covers everything the research literature currently tells us about TB-500: what it is at a molecular level, where it comes from, what mechanisms have been identified in laboratory settings, what the peer-reviewed studies actually say (including their limitations), and how it compares to related research peptides. We also walk through the regulatory and legal landscape so you have a clear picture of the framework governing research compounds in the United States.

Whether you are a scientist reviewing compounds for a new study, a curious reader wanting to understand the science, or a researcher looking to evaluate sourcing options, this guide is built to give you a reliable foundation.

---

Table of Contents

1. What Is TB-500? A Plain-Language Overview
2. Molecular Profile: Structure, Sequence, and Key Properties
3. TB-500 vs. Thymosin Beta-4: Understanding the Distinction
4. Mechanism of Action: What the Research Literature Describes
5. Research Findings by Tissue System
6. TB-500 and Angiogenesis Research
7. Anti-Inflammatory Pathways Studied in Preclinical Models
8. TB-500 vs. BPC-157: How These Two Research Peptides Compare
9. Research Peptides Commonly Studied Alongside TB-500
10. Regulatory and Legal Framework
11. Purity Standards and What to Look for in Research-Grade TB-500
12. Frequently Asked Questions
13. Peer-Reviewed Citations

---

What Is TB-500? A Plain-Language Overview

TB-500 is a synthetic heptapeptide, meaning it is a laboratory-produced chain of seven amino acids. Its sequence is Ac-LKKTETQ, where the "Ac" prefix signals N-terminal acetylation. This acetylation is not cosmetic: it protects the peptide from enzymatic degradation and is widely considered essential to its functional stability in experimental models.

The peptide was developed as a synthetic analog of a specific segment within Thymosin Beta-4 (Tβ4), a naturally occurring 43-amino acid protein found in virtually every mammalian cell type. Tβ4 itself was first isolated from calf thymus tissue in the late 1960s by researcher Allan Goldstein and colleagues. Over the following decades, researchers discovered it was not uniquely a thymic molecule at all. It turned out to be one of the most abundant intracellular peptides in the body, present at concentrations sometimes reaching 0.5 mM in certain cell types.

The segment that became TB-500 corresponds to residues 17 through 23 of the full Tβ4 sequence. Researchers identified this stretch, specifically the LKKTETQ motif, as the region most directly responsible for the peptide's interaction with globular actin, which made it a compelling target for synthetic reproduction and isolated study.

Today, TB-500 is sold by research peptide vendors exclusively as a laboratory research compound. It is not approved as a drug, supplement, or therapeutic agent for any indication in humans or animals. Its scientific interest lies entirely in what it reveals about cell biology when used as a tool in controlled research settings.

Shop our research-grade TB-500: View TB-500 Product Page | Verified purity via third-party HPLC and mass spectrometry.

---

Molecular Profile: Structure, Sequence, and Key Properties

Understanding TB-500 starts with understanding what you are actually working with at the molecular level. The table below summarizes the core specifications researchers need when evaluating or characterizing this compound.

TB-500 Quick Reference Table

Property	TB-500 (Ac-LKKTETQ)	Thymosin Beta-4 (Full Length)
Type	Synthetic heptapeptide	Endogenous 43-AA polypeptide
Amino Acid Sequence	Ac-LKKTETQ	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Molecular Formula	C38H68N10O14	C212H350N56O78S
Molecular Weight	~889 g/mol	~4,921 to 4,963 g/mol
PubChem CID	62707662	45382195
CAS Number	476014-70-7	61512-21-8
Also Known As	Fequesetide; TB-500; Thymosin Beta-4 (17-23)	Tβ4; Timbetasin; TB4
N-Terminal Modification	Acetylated	Acetylated
Disulfide Bonds	None	None
Gene Encoding (full-length)	N/A (synthetic)	TMSB4X (X chromosome)
Research Solubility	Water-soluble	Water-soluble

The absence of disulfide bonds in both molecules is worth noting for researchers designing reconstitution and storage protocols, as it simplifies handling compared to cysteine-containing peptides.

A Note on the N-Terminal Acetylation

The "Ac" designation in front of LKKTETQ means the peptide's N-terminus carries an acetyl group permanently attached during synthesis. This is different from temporary protecting groups used during solid-phase peptide synthesis, which are removed before the final product is released. Permanent acetylation is a common strategy to improve a peptide's resistance to aminopeptidase enzymes that would otherwise cleave it from the N-terminal end. Research suggests this modification also influences the peptide's binding characteristics and overall biological activity in experimental systems.

---

TB-500 vs. Thymosin Beta-4: Understanding the Distinction

This is one of the most common points of confusion in the peptide research literature, and it matters for anyone evaluating study results carefully.

Thymosin Beta-4 (Tβ4) is a full 43-amino acid protein produced endogenously by the body. It is encoded by the TMSB4X gene on the X chromosome and is widely expressed across tissue types. The WHO has assigned it the international nonproprietary name "timbetasin." In addition to the central actin-binding domain, the full-length molecule contains:

• A nuclear localization signal (residues 26 through 31)
• A C-terminal region involved in receptor interactions and downstream signaling
• An integrin-binding motif that facilitates cellular adhesion and migration
• The N-terminal tetrapeptide Ac-SDKP, which has its own documented biological activity related to hematopoietic stem cell regulation

TB-500, by contrast, encompasses only residues 17 through 23 of that sequence. While it retains the core actin-binding motif that drives much of Tβ4's cytoskeletal activity, it lacks the additional domains that contribute to the full peptide's broader range of interactions in experimental models. Some studies using truncated analogs have estimated that the first 17 amino acids of Tβ4 alone retain roughly 60% of the biological activity observed with the complete sequence, underscoring how much the surrounding architecture matters.

For researchers, this distinction is not a trivial technicality. Results from studies using full-length recombinant Tβ4 cannot be directly extrapolated to TB-500 without accounting for the differences in domain composition. The two terms are often used interchangeably in casual discussion, but careful reading of primary sources almost always reveals which molecule was actually used in the experimental protocol.

Also explore: Thymosin Alpha-1 Research Overview | Full Peptide Research Library

---

Mechanism of Action: What the Research Literature Describes

The scientific literature identifies several distinct but interconnected mechanisms by which TB-500 and its parent molecule Tβ4 exert effects in laboratory models. These mechanisms are not exclusive of one another. They appear to work in parallel and sometimes synergistically, which contributes to the broad range of tissue systems researchers have studied.

Actin Sequestration and Cytoskeletal Regulation

The most foundational and well-characterized mechanism involves the peptide's interaction with globular actin, or G-actin. Actin is one of the most abundant proteins in eukaryotic cells, making up as much as 10% of total intracellular protein content in some cell types. Its dynamic polymerization into filaments (F-actin) and subsequent depolymerization back into monomers is central to nearly every aspect of cell movement, shape change, and structural organization.

TB-500 acts as a G-actin sequestering molecule. By binding to actin monomers and preventing their premature assembly into filaments, it maintains a ready pool of unpolymerized actin that can be rapidly mobilized when the cell needs to migrate, divide, or remodel its structure. Researchers have described this as a kind of "on-demand" actin reservoir that cells draw from during the cytoskeletal remodeling that follows tissue injury.

In cell migration assays, this mechanism has been linked to enhanced directional movement of endothelial cells and progenitor cells toward sites of experimental tissue damage, a process that underlies many of the wound healing observations reported across preclinical models.

Integrin-Linked Kinase Activation and Cell Survival Signaling

Beyond direct actin interaction, Tβ4 has been studied for its effects on the integrin-linked kinase (ILK) pathway. In laboratory models, the peptide activates ILK, which in turn phosphorylates Akt (protein kinase B), a key regulator of cell survival, growth, and motility. This PI3K/Akt pathway is considered one of the most important pro-survival signaling cascades in mammalian cells, with documented roles in protecting cells from apoptosis under oxidative stress conditions.

Researchers studying ischemia-reperfusion injury models have been particularly interested in this pathway because of its potential relevance to cardiomyocyte survival following oxygen deprivation.

NF-kB Inhibition and Inflammatory Modulation

A third area of documented activity involves the nuclear factor kappa B (NF-kB) pathway, a master transcriptional regulator of the inflammatory response. Preclinical literature indicates that Tβ4 can inhibit the nuclear translocation of RelA/p65, a key NF-kB subunit, thereby preventing the activation of numerous pro-inflammatory gene targets. Downstream effects observed in experimental models include reduced expression of tumor necrosis factor-alpha (TNF-a), interleukin-8 (IL-8), and other inflammatory mediators.

Angiogenic Signaling

TB-500 and Tβ4 have also been associated with upregulation of vascular endothelial growth factor (VEGF) and promotion of endothelial cell differentiation in laboratory settings. This pro-angiogenic activity is the subject of significant ongoing research interest, particularly in the context of ischemic tissue models where restored vascular supply is a key endpoint.

---

Research Findings by Tissue System

The breadth of preclinical investigation into TB-500 and Thymosin Beta-4 is one of the factors that distinguishes them from many other research peptides. Below is a summary of findings organized by tissue system. All results described here originate from animal model experiments or in vitro cell culture studies. None represent approved clinical applications.

Dermal Wound Healing Models

Some of the earliest and most replicated findings involve dermal wound repair. Animal model studies dating to the late 1990s and early 2000s demonstrated that Tβ4 administration was associated with accelerated wound closure, increased collagen deposition, and reduced scarring compared to control groups.

One set of experiments examined wound healing across three populations of mice: healthy, diabetic, and aged animals. Researchers found that a seven-amino acid synthetic peptide based on the actin-binding portion of Tβ4 (consistent with the TB-500 sequence) promoted repair in aged animals at levels comparable to those observed with the full-length parent molecule. This finding was particularly notable because age-related impairment of wound healing is a clinically relevant challenge, and demonstrating that the shorter fragment could reproduce parent molecule activity expanded interest in synthetic analogs.

In separate studies using subcutaneous implant models in rats, Tβ4-treated subjects showed thicker and longer collagen fiber bundles after 14 days compared to controls, along with measurably reduced wound width and less apparent fibrotic scarring. Researchers identified enhanced fibroblast migration as one of the probable drivers of these observations.

Musculoskeletal and Tendon Models

Rodent studies of skeletal muscle injury have reported associations between Thymosin Beta-4 administration and accelerated muscle fiber regeneration, increased satellite cell proliferation (the progenitor cells responsible for muscle repair), and reduced fibrotic tissue replacement in recovering areas.

Tendon injury models have produced similarly notable findings. Experiments using surgically induced Achilles tendon injuries in rats found that Tβ4-treated subjects demonstrated statistically significant improvements in tendon tensile strength and collagen organization compared to untreated controls. The peptide's documented role in promoting type I collagen organization has been cited as a probable underlying mechanism.

Cardiovascular and Cardiac Research

The cardiac research literature on Thymosin Beta-4 is substantial and has generated considerable scientific interest. Landmark work published in Nature in 2007 demonstrated that Tβ4 could mobilize epicardial progenitor cells in adult mice and promote neovascularization in ischemic cardiac tissue, findings that fundamentally changed how researchers thought about the peptide's potential scope.

Subsequent animal studies examined Tβ4 in models of myocardial infarction and found associations with improved cardiac function markers, reduced infarct size, and enhanced angiogenesis in the damaged myocardium. Research using pig models of chronic myocardial ischemia also reported increased neovascularization and improved hemodynamic endpoints following Tβ4 treatment.

One particularly striking line of investigation showed that Tβ4 appeared capable of activating epicardial progenitor cells even in the absence of cardiac injury, suggesting that the peptide's effects on progenitor mobilization were not strictly dependent on a hypoxic stimulus.

It should be noted that virtually all of this cardiovascular work involves the full-length Tβ4 molecule rather than the shorter TB-500 fragment. Direct extrapolation to TB-500 requires careful consideration of the domain differences outlined earlier.

Neurological Research Models

Preclinical neurological research has examined Tβ4 in traumatic brain injury models, spinal cord injury models, and autoimmune encephalomyelitis models that serve as proxies for neuroinflammatory conditions. Reported findings have included improvements in functional neurological endpoints, reduced inflammatory infiltration, and enhanced oligodendrocyte progenitor populations in treated animals compared to controls.

In the autoimmune encephalomyelitis research specifically, groups receiving Tβ4 showed reductions in inflammatory infiltrates and improvements in remyelination markers. Researchers characterized these findings as preliminary support for the hypothesis that the peptide's anti-inflammatory and progenitor-mobilizing properties might have relevance in neuroinflammatory research contexts.

Corneal and Ocular Research

Ocular research represents one of the areas where Thymosin Beta-4 has advanced furthest along the translational pipeline, with some clinical trials in human subjects having been conducted. Corneal wound healing studies have consistently shown that Tβ4 accelerates epithelial repair, reduces inflammation, and promotes cellular migration across the corneal surface in both animal models and human subjects. This body of work has been described in peer-reviewed reviews as demonstrating a favorable safety profile in tested contexts.

A 2023 publication in International Immunopharmacology examined the potential of Tβ4 as an adjunct in bacterial keratitis treatment, representing ongoing interest in translating preclinical corneal findings into clinical investigation.

---

TB-500 and Angiogenesis Research

Angiogenesis, the formation of new blood vessels from existing vasculature, is one of the most extensively studied outcomes in TB-500 and Tβ4 preclinical research. The interest here is intuitive: adequate vascular supply is a prerequisite for tissue survival and repair, and any agent that promotes controlled neovascularization in experimental models is of significant scientific relevance.

Research as early as 2003 established that the actin-binding domain of Thymosin Beta-4 was itself sufficient to promote angiogenesis, suggesting that TB-500 as a shorter synthetic fragment might retain this activity. In vitro endothelial cell migration assays have consistently shown that exposure to Tβ4 and related fragments enhances directional cell movement, a precursor event to vessel sprouting.

Animal model work has linked Tβ4 administration to measurably increased capillary density in ischemic tissue regions. Researchers studying peripheral ischemia models found that treated animals developed more robust collateral vasculature than controls, an observation that has sustained interest in the peptide's potential relevance for research into ischemic disease biology.

The proposed mechanism centers on VEGF upregulation and enhanced endothelial progenitor cell activity, both of which are downstream effects consistent with what the broader mechanistic literature describes about Tβ4's interactions with the ILK/Akt pathway.

---

Anti-Inflammatory Pathways Studied in Preclinical Models

The anti-inflammatory dimension of TB-500 research is closely intertwined with its regenerative activity. In many tissue injury contexts, excessive or prolonged inflammation impairs healing and promotes fibrotic scarring rather than functional tissue restoration. The research literature suggests that Tβ4 operates on several inflammatory pathways simultaneously.

As noted in the mechanism section, NF-kB inhibition is the most well-characterized anti-inflammatory pathway. By blocking the nuclear translocation of the RelA/p65 subunit, Tβ4 can reduce the transcriptional output of a wide range of pro-inflammatory cytokines and chemokines in experimental models.

Additionally, oxidized Thymosin Beta-4, the sulfoxide derivative formed when an oxygen atom is added to the methionine near the N-terminus, has been studied for effects on neutrophil behavior. Research indicates this derivative can inhibit neutrophil adhesion to endothelial cells and modulate their chemotactic responses, effects that could reduce early inflammatory tissue damage in injury models.

Tβ4 has also been associated with reductions in reactive oxygen species (ROS), upregulation of anti-oxidative enzymes, and suppression of pro-inflammatory toll-like receptor (TLR) signaling in certain experimental contexts. The convergence of these effects across multiple inflammatory pathways contributes to the hypothesis that the peptide creates a permissive environment for tissue regeneration by quieting the acute inflammatory response without fully suppressing immune function.

---

TB-500 vs. BPC-157: How These Two Research Peptides Compare

Researchers frequently encounter TB-500 and BPC-157 discussed in parallel, and for good reason. Both are among the most extensively studied synthetic peptides in the tissue repair and regeneration literature. Understanding how they differ helps clarify why some research programs favor one, the other, or a combination.

Comparison Overview

Feature	TB-500 (Ac-LKKTETQ)	BPC-157
Origin	Synthetic fragment of endogenous Tβ4	Synthetic fragment derived from gastric protective protein
Amino Acids	7	15
Primary Mechanism	Actin sequestration, cytoskeletal modulation	Growth factor receptor interactions, nitric oxide modulation
Angiogenesis Activity	Documented in multiple preclinical models	Documented; different signaling pathways
Anti-Inflammatory Activity	NF-kB inhibition, oxidative stress modulation	Multiple pathways including cyclooxygenase inhibition
Tissue Specificity (preclinical)	Strong signal in cardiac, neural, and dermal models	Strong signal in GI, musculoskeletal, and vascular models
Cardiac Research Volume	High (Nature 2007, multiple follow-on studies)	Moderate
GI Research Volume	Low to moderate	High
FDA Status	Not approved; research use only	Not approved; research use only

The key takeaway is that these peptides are complementary rather than interchangeable. TB-500's actin-centered mechanism gives it particular relevance in research contexts focused on cytoskeletal dynamics, cell migration, and cardiovascular biology. BPC-157's gastric-derived origin and documented GI-protective activity in preclinical models make it a more natural fit for gastrointestinal and mucosal biology research.

Explore related products: BPC-157 Research Page | View all Palmetto Peptides Research Compounds

---

Research Peptides Commonly Studied Alongside TB-500

TB-500 does not exist in isolation within the research peptide landscape. Several other compounds are frequently examined in related or overlapping research programs.

Thymosin Alpha-1 (Ta1) is the other well-known thymosin peptide and represents a functionally distinct molecule. Where TB-500 (derived from Tβ4) is associated with actin regulation and tissue repair, Thymosin Alpha-1 is studied primarily for its immunomodulatory effects, including T-cell activation and modulation of dendritic cell function. The two peptides are often discussed alongside each other in the immunology literature but address different biological questions in research settings.

CJC-1295 is a growth hormone-releasing hormone analog frequently studied in the context of growth hormone pulse modulation. Researchers interested in tissue homeostasis and metabolic biology sometimes evaluate it in combination protocols with TB-500, though these represent experimental frameworks rather than established or approved applications.

Ipamorelin is a growth hormone secretagogue peptide studied for its selective stimulation of growth hormone release in animal models. Like CJC-1295, it appears in research designs alongside TB-500 when investigators are exploring multi-peptide approaches to tissue repair biology.

BPC-157, as covered above, is the most direct research counterpart to TB-500 and the peptide most commonly studied in comparison or combination with it.

See also: Thymosin Alpha-1 Research Page | CJC-1295 Research Page | Ipamorelin Research Page

---

Regulatory and Legal Framework

This is a topic that warrants clear, direct treatment rather than vague disclaimers buried at the bottom of a page.

FDA Status

TB-500 is not approved by the U.S. Food and Drug Administration for any indication, in any population, for any route of administration. It is not a licensed drug, an approved supplement, or an authorized veterinary medicine. The full-length Thymosin Beta-4 molecule has been the subject of FDA-approved clinical trials for specific indications (including wound healing and dry eye), but those investigations involved a distinct compound under strict investigational new drug (IND) protocols and do not extend approval to TB-500 or to retail research compound sales.

In the United States, TB-500 is legal to purchase and possess as a research compound when it is acquired for legitimate in vitro laboratory research purposes by qualified researchers. It may not be sold for human consumption, for administration to animals, or as a dietary supplement. Vendors who market it otherwise are operating outside the bounds of applicable law.

WADA Classification

The World Anti-Doping Agency (WADA) prohibits TB-500 in competition for athletes subject to anti-doping regulations. It appears on WADA's prohibited list under peptide hormones, growth factors, and related substances. Competitive athletes and support personnel in regulated sports should be aware of this classification.

International Regulatory Variation

Regulatory status outside the United States varies meaningfully by country. In Australia and New Zealand, TB-500 is classified as a prescription medicine, making possession without a prescription unlawful. Researchers and institutions operating internationally should consult jurisdiction-specific regulations before acquiring or working with this compound.

Palmetto Peptides' Position

Palmetto Peptides sells TB-500 exclusively as a research compound intended for in vitro laboratory use by qualified researchers. We do not represent that any of our products are suitable for human or veterinary use, and we do not support or encourage any use outside of lawful laboratory research contexts. All purchasers are required to confirm they are acquiring products for research purposes and that they are 21 years of age or older.

---

Purity Standards and What to Look for in Research-Grade TB-500

The quality of research data is only as good as the quality of the compounds used. This is not a minor consideration for TB-500 research.

What Defines Research-Grade Purity

For a peptide to be reliably useful in research settings, vendors should be able to provide third-party analytical documentation confirming identity and purity. The industry standard methods for this are:

High-Performance Liquid Chromatography (HPLC): Provides a purity percentage by separating and quantifying compound components. Research-grade TB-500 should carry HPLC-verified purity of at least 98%.

Mass Spectrometry (MS): Confirms molecular identity by measuring the mass-to-charge ratio of ionized compound fragments. For TB-500, researchers should expect confirmation of the expected molecular weight consistent with Ac-LKKTETQ.

LC-MS/MS: Tandem mass spectrometry following HPLC separation enables sequence confirmation through peptide fragmentation analysis, providing the highest level of identity verification.

Certificate of Analysis (CoA): A document issued by the manufacturer or an independent third-party laboratory summarizing the analytical results for a specific batch. Researchers should receive a CoA with every purchase and should verify it references the specific lot number of the product received.

Storage and Reconstitution Considerations

Lyophilized (freeze-dried) TB-500 powder should be stored at temperatures between 2 and 8 degrees Celsius for short-term use or at minus 20 degrees Celsius for longer-term storage. The peptide's water-soluble profile and absence of disulfide bonds make reconstitution in sterile water or appropriate research buffers relatively straightforward. Detailed reconstitution protocols should always follow the specifications provided with your specific product lot.

Palmetto Peptides research-grade TB-500 is produced via solid-phase peptide synthesis and tested by independent third-party laboratories before release. View product specifications and current CoA here.

---

Summary of Key Research Themes

To consolidate what the literature describes across the tissue systems and mechanisms covered above, the following table provides a quick reference to the major research themes and their preclinical status.

TB-500 and Tβ4: Preclinical Research Theme Summary

Research Theme	Primary Model Systems	Key Proposed Mechanisms	Stage of Investigation
Dermal wound healing	Rodent wound models (healthy, diabetic, aged)	Fibroblast migration, collagen remodeling, actin dynamics	Preclinical; corneal studies extended to human trials
Musculoskeletal repair	Rodent muscle and tendon injury models	Satellite cell proliferation, collagen organization	Preclinical
Cardiac tissue research	Mouse, rat, and pig cardiac ischemia models	Epicardial progenitor activation, neovascularization	Preclinical
Neurological models	Rodent TBI, SCI, and encephalomyelitis models	Anti-inflammatory effects, oligodendrocyte progenitor support	Preclinical
Angiogenesis	In vitro endothelial assays, animal ischemia models	VEGF upregulation, endothelial cell migration	Preclinical and in vitro
Anti-inflammatory effects	Multiple model systems	NF-kB inhibition, ROS reduction, TLR suppression	Preclinical
Corneal and ocular repair	Animal models and human clinical trials	Epithelial migration, inflammation reduction	Advanced preclinical; some clinical data

---

Frequently Asked Questions

What is TB-500?

TB-500 is a synthetic heptapeptide corresponding to the N-acetylated active fragment (amino acids 17 to 23) of the naturally occurring peptide Thymosin Beta-4. Its amino acid sequence is Ac-LKKTETQ, with a molecular weight of approximately 889 g/mol. It is sold strictly as a research compound and is not approved by the FDA for human or veterinary use.

What is the difference between TB-500 and Thymosin Beta-4?

Thymosin Beta-4 (Tβ4) is a naturally occurring 43-amino acid peptide encoded by the TMSB4X gene with a molecular weight of approximately 4,921 g/mol. TB-500 is a shorter, synthetic heptapeptide (7 amino acids) derived from the actin-binding region of Tβ4. Both contain the LKKTETQ motif central to actin regulation, but the full-length Tβ4 includes additional functional domains not present in TB-500.

What has research shown about TB-500 and tissue repair?

Preclinical and in vitro research has associated TB-500 and Thymosin Beta-4 with accelerated wound closure, increased angiogenesis, enhanced cellular migration, and reduced inflammatory markers in controlled laboratory settings. These findings come from animal model studies and cell culture experiments. They do not represent approved therapeutic applications.

Is TB-500 legal to purchase in the United States?

In the United States, TB-500 is legal to purchase as a research compound for qualified laboratory and scientific use. It is not approved for human consumption or veterinary use and should not be sold or used for those purposes. Regulatory status varies internationally, so researchers outside the U.S. should verify applicable laws in their jurisdiction.

What is the molecular structure of TB-500?

TB-500 (Ac-LKKTETQ, also called fequesetide) is a synthetic heptapeptide with the amino acid sequence Leucine-Lysine-Lysine-Threonine-Glutamic acid-Threonine-Glutamine. Its molecular formula is C38H68N10O14, and its molecular weight is approximately 889 g/mol. The N-terminal acetylation is a permanent modification that improves stability.

How does TB-500 relate to actin regulation in research models?

TB-500 contains the LKKTETQ actin-binding motif conserved across the beta-thymosin family. In experimental contexts, this sequence interacts with globular actin (G-actin), preventing premature polymerization and maintaining a ready pool of actin monomers for rapid cytoskeletal remodeling. Laboratory studies have linked this to enhanced cell migration and structural tissue remodeling endpoints.

What research peptides are commonly studied alongside TB-500?

BPC-157 is the most frequently compared research peptide. Others studied alongside TB-500 in overlapping research frameworks include Thymosin Alpha-1, CJC-1295, and Ipamorelin. Each addresses different biological questions, and their overlap with TB-500 research tends to occur in multi-peptide experimental designs exploring tissue homeostasis or regenerative biology.

Can TB-500 be used for humans or animals?

No. TB-500 sold by Palmetto Peptides and other research compound vendors is intended strictly for in vitro laboratory research use. It is not approved by the FDA for human or veterinary use and should not be administered to humans or animals under any circumstances. Any use outside a certified research context is outside the intended scope of these products.

---

Peer-Reviewed Citations

The following peer-reviewed publications informed the research described in this guide. Researchers seeking primary sources are encouraged to access these directly via PubMed, DOI links, or institutional library access.

1. Goldstein AL, Hannappel E, Kleinman HK. Thymosin beta4: actin-sequestering protein moonlights to repair injured tissues. Trends in Molecular Medicine. 2005;11(9):421-429. doi:10.1016/j.molmed.2005.07.004

2. Low TL, Hu SK, Goldstein AL. Complete amino acid sequence of bovine thymosin beta 4: a thymic hormone that induces terminal deoxynucleotidyl transferase activity in thymocyte populations. Proceedings of the National Academy of Sciences USA. 1981;78(2):1162-1166. doi:10.1073/pnas.78.2.1162

3. Smart N, Risebro CA, Melville AAD, Moses K, Schwartz RJ, Bhatt DL, Riley PR. Thymosin Beta-4 induces adult epicardial progenitor mobilization and neovascularization. Nature. 2007;445(7124):177-182. doi:10.1038/nature05383

4. Malinda KM, Goldstein AL, Kleinman HK. Thymosin beta4 stimulates directional migration of human umbilical vein endothelial cells. Journal of Investigative Dermatology. 1999;113(3):364-368. doi:10.1046/j.1523-1747.1999.00708.x

5. Philp D, Huff T, Gho YS, Hannappel E, Kleinman HK. The actin binding site on thymosin beta4 promotes angiogenesis. FASEB Journal. 2003;17(14):2103-2105. doi:10.1096/fj.03-0121fje

6. Philp D, Kleinman HK. Animal studies with thymosin beta, a multifunctional tissue repair and regeneration peptide. Annals of the New York Academy of Sciences. 2010;1194:81-86. doi:10.1111/j.1749-6632.2010.05479.x

7. Maar K, Thatcher JE, Karpov E, Rendeki S, Gallyas F Jr, Bock-Marquette I. Thymosin Beta-4 and Derivatives as Regenerative Therapeutics: A Literature Review. Cells. 2021;10(6):1343. doi:10.3390/cells10061343

8. Bock-Marquette I, Saxena A, White MD, DiMaio JM, Srivastava D. Thymosin beta4 activates integrin-linked kinase and promotes cardiac cell migration, survival and cardiac repair. Nature. 2004;432(7016):466-472. doi:10.1038/nature03020

9. Sosne G, Kleinman HK. Primary mechanisms of thymosin beta4 repair activity in dry eye disorders and other tissue injuries. Investigative Ophthalmology and Visual Science. 2015;56(9):5110-5117. doi:10.1167/iovs.15-17056

10. Sosne G, Berger EA. Thymosin beta 4: A potential novel adjunct treatment for bacterial keratitis. International Immunopharmacology. 2023;118:109953. doi:10.1016/j.intimp.2023.109953

11. Xiong Y, Mahmood A, Meng Y, Zhang Y, Zhang ZG, Morris DC, Chopp M. Neuroprotective and neurorestorative effects of thymosin beta4 treatment following experimental traumatic brain injury. Annals of the New York Academy of Sciences. 2012;1270:51-58. doi:10.1111/j.1749-6632.2012.06683.x

12. Ziegler T, Bahr A, Howe A, Klett K, Husada W, Weber C, Laugwitz KL, Kupatt C, Hinkel R. Thymosin Beta-4 increases neovascularization and cardiac function in chronic myocardial ischemia of normo- and hypercholesterolemic pigs. Molecular Therapy. 2018;26(7):1706-1714. doi:10.1016/j.ymthe.2018.06.004

13. Bao W, Ballard VL, Needle S, Hoang B, Lenhard SC, Tunstead JR, Jucker BM, Willette RN, Pipes GCT. Cardioprotection by systemic dosing of thymosin beta four following ischemic myocardial injury. Frontiers in Pharmacology. 2013;4:149. doi:10.3389/fphar.2013.00149

14. Esposito S, Deventer M, Osswald S, van Eenoo P, Rostedt Punga A. Synthesis and characterization of the N-terminal acetylated 17-23 fragment of thymosin beta 4 identified in TB-500. Drug Testing and Analysis. 2012;4(9):733-738. doi:10.1002/dta.1402

15. Faa G, Gerosa C, Fanni D, Nemolato S, Castagnola M, Messana I, Manconi B, Cabras T, Fanari MU, Van Eyken P, Fanos V. Thymosin beta4 and beta10 expression in human organs during development: a review. Cells. 2024;13(13):1115. doi:10.3390/cells13131115

16. Bollini S, Smits AM, Piatkowski M, Zengin E, Dopping-Hepenstal P, Robinson PM. Thymosin beta4: multiple functions in protection, repair and regeneration of the mammalian heart. Expert Opinion on Biological Therapy. 2015;15(Suppl 1):S163-174. doi:10.1517/14712598.2015.1022526

17. Goldstein AL, Kleinman HK. Advances in the basic and clinical applications of thymosin beta4. Expert Opinion on Biological Therapy. 2015;15(Suppl 1):139-145. doi:10.1517/14712598.2015.1011617

18. Huff T, Muller CS, Otto AM, Netzker R, Hannappel E. Beta-thymosins, small acidic peptides with multiple functions. International Journal of Biochemistry and Cell Biology. 2001;33(3):205-220. doi:10.1016/s1357-2725(00)00087-x

---

Final Disclaimer: All content on this page is for informational and educational purposes only. TB-500 and all products offered by Palmetto Peptides are strictly research compounds intended for in vitro laboratory use by qualified researchers. These products are not approved by the FDA and are not intended for human consumption, veterinary use, or any therapeutic application. Palmetto Peptides makes no claims regarding the efficacy, safety, or suitability of any compound for any health-related use. Researchers are responsible for complying with all applicable federal, state, and local regulations governing the purchase, possession, and use of research compounds.

---

Author: Palmetto Peptides Research Team
Organization: Palmetto Peptides
Last Updated: March 19, 2026

Palmetto Peptides is committed to providing the research community with accurate, science-grounded educational content. Our research library is reviewed and updated regularly as new peer-reviewed literature becomes available.

Explore the Palmetto Peptides Research Library: Full Research Index | Shop Research Peptides